Athletes to have represented OUCCC in the Varsity Matches

Each athlete to have represent Oxford in a Blues Varsity Match joins a long list of distinguish Men and Women to have achieved such honour. To mark the significance of the achievement each athlete is given an individual number which is embroidered onto their Blues vest.

C.W.Grinstead (Keble) and J.C.Halfpenny (St. Hugh's) are given No.1 as the respective Gentlemen's and Ladies' Captains in the original Varsity Matches, while A.F.Hernaman (Keble) and L.Wightman (Lady Margaret Hall) are given No.2 for their respective wins in the first Varsity Matches. Following this the list is arranged in the order in which each athlete debuted for the OUCCC Blues Team. Where more than one athlete debuted in the same match, those athletes are listed alphabetically by surname.

No. Name College Debut Year
1 Grinstead, C.W. Keble/Charsley's Hall 1880
2 Hernaman, A.F. Keble 1880
3 Edwards, F.H. University 1880
4 Hewetson, J. Worcester 1880
5 Payne, P.G.S. University 1880
6 Carter, E.C. St. John's 1881
7 Wooldridge, G.F. Keble 1881
8 Paton, A.V. Trinity 1882
9 Way, H.E.H. Non-collegiate 1882
10 Bassano, C.W. Balliol 1883
11 Edgell, W.S. St. John's 1883
12 James, M.V. Lincoln 1883
13 Nevill, E.R. Lincoln 1883
14 Bassano, A.H. Balliol 1884
15 Collinson, E.deL. New College 1884
16 Guille, H.G.deC. Trinity 1884
17 Turrell, W.J. Turrell's Hall 1884
18 Cary, H.L.M. Oriel 1885
19 Cross, F.J.K. New College 1885
20 Jepson, E.A. Balliol 1885
21 Kent, I. New College 1885
22 Pollock Hill, W. Keble 1886
23 Sadler, F.J. Wadham 1886
24 West, W.W. Christ Church 1886
25 Dawbarn, A.Y. Balliol 1887
26 Fowler, A.J. Corpus Christi 1887
27 Jones, E.M. New College 1887
28 Shaw, P.J. New College 1887
29 Andrews, A.W. Magdalen 1888
30 Cooke, A. New College 1888
31 Vavasour, R.St.J. Worcester 1888
32 Egerton, W. Corpus Christi 1889
33 Pease, C.A. Lincoln 1889
34 Hawes, I.H.S. Hertford 1891(i)
35 Mitchell, A.E. Merton 1891(i)
36 Scott, A.V.A. Keble 1891(i)
37 Dove, J. New College 1891(ii)
38 Finch, H.E. Keble 1891(ii)
39 Manning, P. New College 1891(ii)
40 Reynolds, C.A. Keble 1891(ii)
41 Rivington, H.G. Worcester 1892
42 Whitelaw, W.H. New College 1892
43 Crickmay, T.F. Hertford 1893
44 Edmunds, L.W. Queen's 1893
45 Murphy, J.K. Brasenose 1893
46 Shuckburgh, H.F.B. Wadham 1893
47 Beak, G.B. Queen's 1894
48 Nixon, L.H. Keble 1894
49 Amery, L.C.M.S. Balliol 1895
50 Bevers, E.C. St. John's 1895
51 Grayson, E.N. Balliol 1895
52 Turner, C.H. Keble 1895
53 Attenborough, G. University 1896
54 Barrett, P.G. Oriel 1896
55 Johnson, H.M. St. John's 1896
56 Sadler, W.D. Oriel 1896
57 Townshend, G. Hertford 1896
58 Baines, P.M. University 1897
59 Shaw, A.J.M. St. John's 1897
60 Bunbury, H.N. St. John's 1898
61 Dawson, E.A. Worcester 1898
62 Harrison, J. St. John's 1898
63 Kinsman, J.C.P. Queen's 1898
64 Summersell-Davis, H. Corpus Christi 1898
65 Fothergill, G.R. New College 1899
66 Gull, C.B.R. St. Edmund Hall 1899
67 Marshall, R.P. Keble 1899
68 Strickland, W.R. Keble 1899
69 Briscoe, H.K. Pembroke 1900
70 Huxtable, A.H. University 1900
71 Sharp, R.R. Christ Church 1900
72 Gay-Roberts, E.L. Queen's 1901
73 Godby, M.H. Christ Church 1901
74 Birt, R.H.C. New College 1902
75 Hodge, C.E.V. Christ Church 1902
76 Harcourt, S.E.V. Christ Church 1903
77 Huyshe, R.R. Oriel 1903
78 Huyshe, O.F. Keble 1904
79 Johnston, H.T. Corpus Christi 1904
80 Schutt, W.E. Brasenose 1904
81 Butler, G.S. Keble 1905
82 Carnelly, S.H. Exeter 1905
83 Pearson, H.W. Keble 1905
84 Sonnenschein, W.T.S. Christ Church 1905
85 Maїs, S.P.B. Christ Church 1906
86 Sainsbury, J. Oriel 1906
87 Smith, N.E. Keble 1906
88 Hodson, R.V. Wadham 1907
89 Seacombe, R.S. Keble 1907
90 Worsley, J.F. Magdalen 1907
91 Clemes, A.W. Magdalen 1908
92 Haigh, M.G. New College 1908
93 Gawan-Taylor, E. Pembroke 1909
94 Knight, A.G. Magdalen 1909
95 Knight, R.E. Pembroke 1909
96 May, R.T. Balliol 1910
97 Moore, W.C. Exeter 1910
98 Porter, C.H.A. Brasenose 1910
99 Garrod, A.G.R. University 1911
100 Sproule, G.M. Balliol 1911
101 Baker, L.D. St. Edmund Hall 1912
102 Gaussen, D.N. St. John's 1912
103 Pocock, T.G. New College 1912
104 Bath, J.E.W. All Souls 1913
105 Faber, E.W. University 1913
106 Pearce, W.J. New College 1913
107 Taber, N.S. St. John's 1913
108 Bolton, A.R.C. Merton 1919
109 Brown, R.P. Trinity 1919
110 Grace, W.A. Queen's 1919
111 Lanyon, J.A. New College 1919
112 Monatgue, E.A. Magdalen 1919
113 Dickinson, J.H. Jesus 1920
114 Herington, S.D. Queen's 1920
115 McInnes, N.A. New College 1920
116 Sutton, R.B. Queen's 1920
117 Brown, R.E. Wadham 1921
118 Green, H.F. Jesus 1921
119 Blagden, J.B. Brasenose 1922
120 Bryant, P.H.M. Queen's 1922
121 Morgan, C.B.E. Christ Church 1922
122 Bell, K.L.H. Brasenose 1923
123 Montague, F.A. Magdalen 1923
124 Yates, A. Brasenose 1923
125 Harley, H.C. Wadham 1924
126 Macbeth, R.G. Oriel 1924
127 Morgan, V.E. Christ Church 1924
128 Walford, A.S. Oriel 1924
129 Cave, R.G.G. Worcester 1925
130 Edwards, W.A.M. Oriel 1925
131 Thomas, I. St. John's 1925
132 Brown, E.H.P. Wadham 1926
133 Cooke, L.A.B. St. John's 1926
134 Downham, R.S. Worcester 1926
135 Bryan-Daunt, P.G. Wadham 1927
136 Pumphrey, J.M. New College 1927
137 Beresford, C.D.de la P. Worcester 1928
138 Cornes, J.F. Corpus Christi 1928
139 Edwards, A.H. Queen's 1928
140 Smellie, N.B. New College 1928
141 Feathers, J.N. Brasenose 1929
142 Moses, N.C. St. Edmund Hall 1929
143 Price, N.S. Queen's 1929
144 Proctor, H.G. Keble 1929
145 Davies, G.G. Oriel 1930
146 Honniball, G.T. Brasenose 1930
147 Mabey, C.J. St. Edmund Hall 1930
148 Swingler, R.C. New College 1930
149 Follows, J.W. St. Catherine's Society 1931
150 Murphie, C.I. Wadham 1931
151 Wiles, G.G. Balliol 1931
152 Albery, P.J. Exeter 1932
153 Healey, C.O. Brasenose 1932
154 Hooper, W.L. Queen's 1932
155 Lovelock, J.E. Exeter 1932
156 Powell, L.S. St. Catherine's Society 1932
157 Edwards, H.G. St. Edmund Hall 1933
158 Watts, B.P.K. St. Peter's Hall 1933
159 Clement, L.B. Lincoln 1934
160 Couper, G.V. Exeter 1934
161 McIntyre, L.R. Exeter 1934
162 Robertson, A.A. Balliol 1934
163 Hawkey, J.K. University 1935
164 Paul, W.D. St. Catherine's Society 1935
165 Percival, R.H. St. John's 1935
166 Atkinson, G.J.L. Jesus 1936
167 Dyson, P. Corpus Christi 1936
168 Priestley, E. Queen's 1936
169 Dewar, E.P. St. Peter's Hall 1937
170 McNair, J.T.H. Exeter 1937
171 Martin, D.R. Balliol 1937
172 Marrian, P.D. Trinity 1938
173 Shirreff, F.D. Oriel 1938
174 Wyatt-Smith, J. Wadham 1938
175 Green, N.M. Magdalen 1945(ii)
176 Mackay, E.N. Wadham 1945(ii)
177 Morgan, P.R.Ll. Wadham 1945(ii)
178 Richardson, R.G. Brasenose 1945(ii)
179 Trottman-Dickensen, A.F. Balliol 1945(ii)
180 Tudor,  G.D.C. Christ Church 1945(ii)
181 Curry, T.P.E. Oriel 1946
182 MacPherson, R.T.S. Trinity 1946
183 Robertson, J.H. Balliol 1946
184 Pollard, J.F. Pembroke 1947
185 Ridding, G. Oriel 1947
186 Bannister, R.G. Exeter 1948
187 Cartwright, D.H. Corpus Christi 1948
188 Haile, P.K. Jesus 1948
189 Hardy, G.St.J. Corpus Christi 1948
190 Lumb, P.B. New College 1948
191 Scott-Wilson, J.H. Magdalen 1948
192 Black, C.J. St. Catherine's Society 1949
193 Bryant, S.J. Lincoln 1949
194 Ewer, I.F. Christ Church 1949
195 Law, D.C. Brasenose 1949
196 Chataway, C.J. Magdalen 1950
197 Fathers, D.E. Magdalen 1950
198 Haddock, J.M.W. Wadham 1950
199 Woodford, E.G. Magdalen 1950
200 Dove, D.W.C. Trinity 1951
201 Woods, S.A. St. Catherine's Society 1951
202 Keyte, V.C. Jesus 1952
203 Miller, P.N. Lincoln 1952
204 Pain, R.H. Queen's 1952
205 Weeks-Pearson, A.J. St. Catherine's Society 1952
206 Aldridge, F.M. Lincoln 1953
207 Boyd, I.H. Brasenose 1953
208 Doorbar, E. Hertford 1953
209 Johnson, D.J.N. Lincoln 1953
210 McKean, J.M. New College 1953
211 Robinson, D.H. Magdalen 1953
212 Suddaby, C.W. Exeter 1953
213 Cole, J.V. Balliol 1954
214 Gordon, A.D. Magdalen 1954
215 Shaw, T.W. St. Peter's Hall 1954
216 Abrahams, P. University 1955
217 Barber, D.W. Merton 1955
218 Evans, P.D. Oriel 1955
219 Morgan, R.B.Ll. Worcester 1955
220 Burnett, D.F. St. Peter's Hall 1956
221 MacLean, D.G. Brasenose 1956
222 Maxwell, C.T. St. John's 1956
223 Richards, D.J.P. Lincoln 1956
224 Eales, J.G. Keble 1957
225 Howes, J.R. Christ Church 1957
226 James, S.H. Brasenose 1957
227 Kenwright, S. Lincoln 1957
228 Montague, P.McC. Balliol 1957
229 Saville, J.D. Oriel 1957
230 Banner, P.T.J. University 1958
231 Burnett, H.W. St. Peter's Hall 1958
232 Esson, J. St. Catherine's Society 1958
233 Gilligan, K.J.L. Wadham 1958
234 Bell, R.E. St. Catherine's Society 1959
235 Thorn,  R.T. Exeter 1959
236 Wood,  A.J. St. Catherine's Society 1959
237 Boulter, J.P. Queen's 1960
238 Cummings, W.A.V. Christ Church 1960
239 Harvey, R.W. St. Edmund Hall 1960
240 Hull, R.A. Queen's 1960
241 Bell, R. Brasenose 1961
242 Blake, J.D. Trinity 1961
243 Johns, R.T.M. Queen's 1961
244 Johnson, K.W. Trinity 1961
245 Llewellyn-Smith, C.H. New College 1961
246 Statham, M.L. St. Edmund Hall 1961
247 Tunnell, G.E. Brasenose 1961
248 Glyde, H.R. Wadham 1962
249 Lunn, J. Exeter 1962
250 Mullin, M.H. Oriel 1962
251 Norton,  R. St. Edmund Hall 1962
252 Coggins, J.R. Queen's 1963
253 Larkum, A.W.D. Wadham 1963
254 Mettrick, D.J. New College 1963
255 Stacey, B. St. Edmund Hall 1963
256 Ashworth, R.S. Christ Church 1964
257 Craven, M.G. St. Edmund Hall 1964
258 Davies, D.H. St. Edmund Hall 1964
259 Muers, M.F. New College 1964
260 Altmann, H. New College 1965
261 Cross, R.B. Worcester 1965
262 Jones, T.L. St. Edmund Hall 1965
263 McBride, G. St. Peter's 1965
264 Peel, R.H. Merton 1965
265 Pullan, H.H.A. New College 1965
266 Waterhouse, J.R. St. Catherine's 1965
267 Braithwaite, P.R.C. University 1966
268 Godding, J. St. Peter's 1966
269 Hatcher, P.J. St. Peter's 1966
270 Larkins, F.P. Wadham 1966
271 Valentine, J.P. St. John's 1966
272 Beckett, J.G. Merton 1967
273 Johns, M.C. St. Edmund Hall 1967
274 Langton, J.R. St. John's 1967
275 Baker, P.J. St. Catherine's 1968
276 Davies, G.C. St. Peter's 1968
277 Richards, H.P. St. Edmund Hall 1968
278 Shemilt, J.F. Pembroke 1968
279 Starkey, H.W. St. John's 1968
280 Cameron, P.J. Balliol 1969
281 Dennis, P.J. Keble 1969
282 Lennon, P. Magdalen 1969
283 Moore, A.T. St. Edmund Hall 1969
284 Rhys, H.P. New College 1969
285 Roberts, A.G. St. Peter's 1969
286 Steele, R.A. New College 1969
287 Horner, S.J. St. Peter's 1970
288 Mitchell, P.J. St. Edmund Hall 1970
289 O'Brien, R.R. Corpus Christi 1970
290 Scarfe, A. St. Edmund Hall 1970
291 Dugdale, G. Christ Church 1971
292 Ewers, W.A. Worcester 1971
293 Swift, P. Christ Church 1971
294 Bromilow, T.M. Trinity 1972
295 Crittenden, R.J. Jesus 1972
296 Firth, M.T. Hertford 1972
297 Goater, J.N. St. Edmund Hall 1972
298 Brewster, R.P. Trinity 1973
299 Etchells, A.J. St. John's 1973
300 Knutzen, R.J. St. Catherine's 1973
301 Reynolds, G.J. New College 1973
302 Irvine, P.J. St. Peter's 1974
303 Rye, J.W. Lincoln 1974
304 Stenton, E.C. Brasenose 1974
305 Brodie, C.N. Magdalen 1975
306 LeGrand, V.P. Merton 1975
307 May, F.R. Trinity 1975
308 Symonds, H.M. St. Catherine's 1975
309 Brawn, N.C.S. Oriel 1976
310 Prest, C.M. Mansfield 1976
311 Standring, P.W. Hertford 1976
312 Aithie, C.J. New College 1977
313 Golding, D. Exeter 1977
314 Masback, C.A. Trinity 1977
315 Shepherd, A.C. Balliol 1977
316 Ewers, A.W. Worcester 1978
317 Holdsworth, R.G. Queen's 1978
318 Schlesinger, D. Wadham 1978
319 Walsh, S.J. Exeter 1978
320 Elgood, M. Queen's 1979
321 Lyne, M.J. Brasenose 1979
322 Nevell, D.A. Queen's 1979
323 Rimmer, M.R. Worcester 1979
324 Yates, T.E. Magdalen 1979
325 Blythe, C.A. Lincoln 1980
326 Darville, M. Pembroke 1980
327 Dorey, N.D.B. New College 1980
328 Chandler, S. Greyfriars 1981
329 Cooper, H.D. Brasenose 1981
330 Fellows, N.R. St. Peter's 1981
331 Gisby, S.J. Exeter 1981
332 Knapp, K.N. Pembroke 1981
333 Bailey, M. Brasenose 1982
334 Noden, J.M. Merton 1982
335 Power, M.J. St. Catherine's 1982
336 Webb, H. Queen's 1982
337 Bromhall, C.P.S. Balliol 1983
338 Kanowski, P.J. St. John's 1983
339 Leach, A.R. Lincoln 1983
340 Nerurkar, R.D. University 1983
341 Teasdale, M. Christ Church 1983
342 Berrett, T.D. Brasenose 1984
343 Geddes, A.P. Brasenose 1984
344 Gilbert, D.M. St. Catherine's 1984
345 King, A. Worcester 1984
346 Robinson, A.N.J. Balliol 1984
347 Brooke, J.K.L. Balliol 1985
348 Thiemicke, A.F.J. St. Catherine's 1985
349 Laws, P.M. Christ Church 1986
350 Mathews, L. Merton 1986
351 Rossiter, J.A. St. Edmund Hall 1986
352 Layton, D.M. Lincoln 1987
353 Mugglestone, S.J. Hertford/Keble 1987
354 Niblett, P. Balliol 1987
355 Richardson, T.E. Oriel 1987
356 Shuttleworth, G.D. St. Anne's 1987
357 Thomas, C.A.M. New College 1987
358 Cook,  C.S. University 1988
359 Dubosky, A.J. Wadham 1988
360 MacFadyen, G.G. Worcester 1988
361 Parry-Billings, M. Wolfson 1988
362 Stirrat, K. St. Edmund Hall 1988
363 Daniels, C.J.W. Worcester 1989
364 McAllister, I.G. Pembroke 1989
365 McMorran, J.P. Merton 1989
366 Evans, M.N. Christ Church 1990
367 Kirk, K.D. Wolfson 1990
368 Walters, M.D. University 1990
369 Baines, S.D.S. Magdalen 1991
370 Collier, R.W. St. Edmund Hall 1991
371 Martin, S.J.E. St. Edmund Hall 1991
372 Sarphie, D. Christ Church 1991
373 Weir, A.P. Magdalen 1991
374 Bateson, M.G. Keble 1992
375 Broom,  C.E. Oriel 1992
376 Nash, J.E. Trinity 1992
377 Willifer, M.L. Lady Margaret Hall 1992
378 Wood,  J.L. University 1992
379 Barrable, N. St. Hugh's 1993
380 Beevers, A.P.G. Brasenose 1993
381 Newey, E.J. Lincoln 1993
382 Sanders, D.R.C. Oriel 1993
383 Beavington, R. University 1994
384 Gaskell, A.P. St. Anne's 1994
385 Haarer, P.S. Balliol 1994
386 Madge, S.N. Magdalen 1994
387 Tyler, G.G. Mansfield 1994
388 Egan, E.O. Green 1995
389 Hart, A.G. University 1995
390 Hennessy, A.D. New College 1995
391 Kirk, D.J. Worcester 1995
392 Funder, J.V. St. Catherine's 1996
393 MacPherson, A.A. University 1996
394 Maxwell, C.R. Worcester 1996
395 Poulin, M.J. New College 1996
396 Talbot, N.P. University 1996
397 Bowyer, R.O. Trinity 1997
398 Bradley, J.J. University 1997
399 Fountain, E.D. New College 1997
400 Molden, S.C. Christ Church 1997
401 Brooks, J.T.S. Linacre 1998
402 Pickering, C.G. Somerville 1998
403 Wakefield, M.J. St. John's 1998
404 Fargus, A.J. St. Catherine's 1999
405 McGill, R.J. Wadham 1999
406 Watterson, S.W. St. John's 1999
407 Whitelam, S.B.B. Trinity 1999
408 Bishop, M.J. St. Hugh's/New College/St. Cath 2000
409 Killingley, P.S. Brasenose/Balliol 2000
410 Moreau, B. Lady Margaret Hall/Wadham 2000
411 Peterson, E.B. Magdalen 2000
412 Watterson, M.P. Linacre 2000
413 Aldridge, A.S. Exeter 2001
414 Davies, G.J. Mansfield 2001
415 Parker, J.S. Balliol 2001
416 Hutchins, J.D. Trinity 2002
417 Taylor, M. Linacre 2002
418 Thompson, F.K. Wolfson/Pembroke 2002
419 Douglas, T.M. Balliol/Christ Church 2003
420 Blackledge, J.E. St. Catherine's 2004
421 Dewhirst, M. Trinity 2004
422 Hogan, J.W. St. Edmund Hall 2004
423 Walton, L.A. Worcester 2004
424 Bruce, D.J. Lady Margaret Hall/Green/Green 2005
425 Chetwynd, A.P. St. Edmund Hall 2005
426 Franzese, R.C. Worcester/Wolfson 2005
427 Granger-Bevan, S. Oriel 2006
428 Kimpton, I.D. Lincoln 2006
429 Mercer, J.M. Pembroke/Green Templeton 2006
430 Ash, G. Keble 2007
431 Howarth, N.A.A. Christ Church 2007
432 Pearson/Pearson-Stuttard, J.A. St. Anne's/Christ Church 2007
433 Ledger, S.R. St. John's 2008
434 Osborne, M.A. New College 2008
435 Samuel, T.W. Brasenose 2008
436 Caldwell, L.A. Jesus 2009
437 Heyes, A.R. St. Hugh's 2009
438 Johnson, M.E. Jesus 2009
439 McGurk, C.P. Wadham 2009
440 Shelley, J.G. Somerville 2009
441 Downs, F. Lady Margaret Hall 2010
442 Scott, F.A.M. Lincoln 2010
443 Frith, T.D. St. Anne's 2011
444 Lanham, A.J. Corpus Christi 2011
445 Mitchell, H.P. Pembroke 2011
446 Muir, A.W. Brasenose 2011
447 Shadbolt, J.A. St. Catherine's 2011
448 Hodkinson, P.J. St. Anne's 2012
449 Mycroft, W. New College 2012
450 Penney, A.M. Lincoln 2012
451 Speake, A.N. Worcester 2012
452 Wiebel, J.W. St. Cross 2012
453 Christofi, W.J.A. University 2013
454 Colopy, G.W. St. Cross 2013
455 Howard, A.J. Christ Church 2013
456 Phillips-Hart, C.W. Worcester 2013
457 Quirk, T.J.K. Jesus 2013
458 Chandler, M.H. Lady Margaret Hall 2014
459 Parkinson, J.R.G. Somerville/Jesus 2014
460 Ryle-Hodges, W.E. St. Antony's 2014
461 Smith, A.L.R. St. John's 2014
462 Unterreiner, M.W. St. John's 2014
463 Cotter, L.M. St. Catherine's 2015
464 Metselaar, L. St. John's 2015
465 Mulryan, D.J. Trinity 2016
466 Spill, J.L. Jesus 2016
467 Totten, E.J. Hertford 2016
468 Weatherseed, M.H.A. Lady Margaret Hall/St. Anne's 2016
469 Bampton, A.C. Lincoln 2017
470 Millar, J.M. University 2017
471 Paulin, O.W. Merton 2017
472 Smith, K.P. Trinity 2017
473 Hurton, N. Mansfield 2018
474 Harrison, T.J. Keble 2018
475 Lefroy, T.R.B. St. Cross 2018
476 Bowness, J.S. Linacre 2019
477 Brown, R.S. Worcester 2019
478 Brown-Araújo, S.O. University 2019
479 Gruen, A.J. Balliol 2019
480 Morrow, J.D. Hertford 2019
481 Bundred, D.W.P. St. John's 2021
482 Burke, B.S. Worcester 2021
483 Campion, M. Hertford 2021
484 D'Aquila, M.D. Wolfson 2021
485 Renshaw, T.D. St. Hugh's 2021
486 Wood, T.J. St. Anne's 2021
487 Fuller, M.E. Corpus Christi 2022
488 Jones, O.T.R. Brasenose 2022
489 Martin, J.A.C. Merton 2022
490 Moulton, N.F. St. Anthony's 2022
491 Barnes, I.M. Oriel 2023
492 Kearney, M.T. Magdalen 2024
493 Parker, C.G. Corpus Christi 2024
494 Ward, J.B. Keble 2024
495 Whittaker, N.J. Wolfson 2024
496 Johnson, J.A. Corpus Christi 2025
497 McCartney, B.A. St Hilda's 2025
498 Poulston, A.J. Merton 2025

 

No. Name College Debut Year
1 Halfpenny, J.C. St. Hugh's 1976
2 Wightman, L. Lady Margaret Hall 1976
3 Grand, J. St. Hilda's 1976
4 Hudson, J.P. St. Anne's 1976
5 Skrine, N.G. St. Hugh's 1976
6 Stead, F.H. Somerville 1976
7 Fogarty, C. Jesus 1977
8 Kingsley, S.A. Somerville 1977
9 Meunier, C.J. St. Hugh's 1976
10 Whitaker, L.E. Wadham 1977
11 Alexander, C.E. Somerville 1978
12 Izzard, W.J. St. Antony's 1978
13 Reeve, K.J. St. Anne's 1978
14 Simpson, C.M.F. St. Anne's 1978
15 Morlock, V. St. Hugh's 1979
16 Murray, A.J. Mansfield 1979
17 Spink, F. Exeter 1979
18 Davidson, S. Jesus 1980
19 Lawrence, J. Somerville 1980
20 Morley, C.J. Christ Church 1980
21 Shore, K. Hertford 1980
22 Simpson, M.L.F. St. Anne's 1980
23 Barton, D. Brasenose 1981
24 Burch,  M.W. Exeter 1981
25 Wells, S. St. Hilda's 1981
26 Maybee, S.H. Trinity 1982
27 Podmore, D. St. Hugh's 1982
28 Sylvester, C.A. Lady Margaret Hall 1982
29 Bliss, E.A. St. Edmund Hall 1983
30 Clair, K.S. St. Hilda's 1983
31 Gore, A. Jesus 1983
32 Dering, S.L. Exeter 1984
33 Gibb, P.J.R. Keble 1984
34 Matthews, C. Trinity 1984
35 Watson, T.J. Queen's 1984
36 Head, L. St. John's 1985
37 Hoyle, H.E. St. Edmund Hall 1985
38 Redcliffe, C. Christ Church 1985
39 Simpson, F.J. Magdalen 1986
40 Vaughan, V.E. Corpus Christi 1986
41 Curtis, N.J. Jesus 1987
42 Elbourne, J.E. St. Antony's 1987
43 Pilling, S.H. Queen's 1987
44 Bush, D.A. Somerville 1988
45 Dering, J.D. Exeter 1988
46 Edwards, J.M. Christ Church 1988
47 Manship, D.L. Keble 1988
48 Berardino, C.L. Keble 1989
49 Sokell, E.J. Somerville 1989
50 Askeland, C. St. Peter's 1990
51 Karlsson, G.B. Merton 1990
52 Fisher, C.G. Somerville 1991
53 Henstridge, J.A. St. Hilda's 1991
54 Slinger, E.R. Jesus 1991
55 Haines, N. St. Edmund Hall 1992
56 Lopes, P. St. Peter's 1992
57 Morrison, H.G. St. Catherine's 1992
58 Myers, M.R. St. Anne's 1992
59 Clark, M.F. Balliol 1993
60 Coleman, E.E. Magdalen 1993
61 Cook,  S. New College 1993
62 Normand, A.M. New College 1993
63 Rees-Jones, J. Hertford 1993
64 Anderson, J.F. Balliol 1994
65 Chung, H.M. Christ Church 1994
66 Cook,  S.J. Lincoln 1994
67 Martin, C.E. Queen's 1994
68 Moulder, H. University 1994
69 Lynch, N.J. St. John's 1995
70 Martin, J. Lady Margaret Hall 1995
71 Cook,  J. St. Edmund Hall 1996
72 Currie, R.J. Worcester 1996
73 Lee, D.R. St. Hilda's 1996
74 O'Hare, E.J. Merton 1996
75 Skorupska, K.W.T. New College 1997
76 Wilder, K.E. Exeter 1997
77 Hasell, L.E. Queen's 1998
78 Wilkinson, J. Green 1998
79 Anderson, K.N. Worcester 1999
80 Craft, J.A. Worcester 1999
81 Hopewell, B. Wolfson 1999
82 Carnwath, G.J. Brasenose 2000
83 Gleason, M.C. Brasenose 2000
84 Zenner, H. Brasenose 2000
85 Dean, H.E. Keble 2001
86 Oscroft, J.V.M. St. Edmund Hall 2001
87 Barnes, H.R. St. Catherine's 2002
88 Bromilow, L.S.F. St. Hugh's 2002
89 Crowley, E.H. St. Anne's 2002
90 Leitch, J.R. St. Edmund Hall 2002
91 Beverly, A. St. Peter's 2003
92 Birch, C.A. Merton 2003
93 Ferenczi, E.A. New College 2003
94 Rowell, A.A.C. University 2003
95 Burgoine, K.L. Worcester 2004
96 Deegan, R.S. St. Hugh's 2004
97 Brathwaite, E.M.P. Mansfield 2005
98 Gibson, L.E.M. Worcester 2005
99 Ward, R.E. Somerville 2005
100 Ansell, C Merton 2006
101 Crocker, A.F. New College 2006
102 Plateau, C.R. Oriel 2006
103 Bates, C. Hertford 2008
104 Sikes, M.M. Lincoln 2008
105 Gardner, B.J. St. Catherine's 2009
106 Kane, C.R. Christ Church 2009
107 Lopez, N.R. Balliol 2009
108 MacInnes, F.I. Lady Margaret Hall 2009
109 Munn, H.J. St. Hugh's 2009
110 Anselin, J. St. Hilda's 2010
111 Poole, N. St. Hilda's 2010
112 Waldman, E.J. Somerville 2010
113 Boyd, J.L. Wadham 2011
114 Carleton, T.A. Magdalen 2011
115 Chen, J.P. Somerville 2011
116 Klaptocz, J.E. St. Hugh's 2011
117 Mullarkey, C.E. Trinity 2011
118 Cole, C.M. Balliol 2012
119 Niehaus, K.E. Trinity 2012
120 Saller, S.M.F. St. Catherine's 2012
121 Webber, N.R. Worcester 2012
122 Hodson, E.J. Merton 2013
123 McIlvennie, C.A. Trinity 2013
124 Moss, E.J. St. Anne's 2013
125 Paulson, S Green Templeton 2013
126 Hickson, K.T. St. Hilda's 2014
127 McCuaig, S.M. St. Hilda's 2014
128 Penfold, R.S. Green Templeton 2014
129 Petty, N.A. Mansfield 2014
130 Chattenton, D.L. Wadham 2015
131 Greenwood, H.E. University 2015
132 Murray, B.R. Jesus 2015
133 Robinson, R.A. Worcester 2015
134 Skokowski, R.A. University 2015
135 Plaschkes, H.H.M. New College 2016
136 Record, H.L.C. Trinity 2016
137 Dannatt, C.A. St. John's 2017
138 Horner, K.M. St. Catherine's 2017
139 Hurton,  C.E. Pembroke 2017
140 Scrafton, W.F.V. Worcester 2017
141 Bolton, E.V.S. Keble 2018
142 Higgs-Sharrock, E.G. Balliol 2018
143 John, L.H. Magdalen 2018
144 Sharp, A.J. Queen's 2018
145 Shipley, A.M. Worcester 2018
146 Apsley, E.J. St. Hilda's 2019
147 Brown, A.E. New College 2019
148 Hammett, C.L. Lincoln 2019
149 Molloy, G.E. St. John's 2019
150 Buckley, C.L.M. Oriel 2021
151 Carroll, E.J.P. Magdalen 2021
152 Major, L. Merton 2021
153 Ridgway, K. Worcester 2021
154 Garner, A. St. Hugh's 2022
155 Owen, M.W. Jesus 2022
156 Thompson, L.E. Somerville 2022
157 Williams, M.L. Corpus Christi 2022
158 Kingston, N.S.M. Queen's 2023
159 McDonald, M.L. Linacre 2023
160 Rawlinson, B.K. St. Hugh's 2023
161 Ridley, J.E. Lady Margaret Hall 2023
162 Woolfe, R.S. Keble 2023
163 Auer, J.C. Magdalen 2024
164 Casajoana Guardia, L. St. John's 2024
165 Flaherty, R.C. St. Catherine's 2024
166 Russell, L.E. Balliol 2024
167 Andrejczuk, H. Lincoln 2025
168 Coleman, A.H.  Pembroke 2025
169 Davey, E.V. Pembroke 2025
170 Glencross, S.H. St Hilda's 2025
171 Schwarze-Chintapatla, A. Trinity 2025
172 Tharenos, A.M. St Antony's 2025

History of the Varsity Matches

The Inter-'Varsity Cross-Country Race is one of the oldest inter-club matches still in existence and has a rich history. Barring the war years, it has been held annually since 1880. The first race was hosted by Oxford and run over a 7½ mile course which started from the Royal Oak pub and covered the Woodstock Road, Cherwell, Water Eaton and Canal areas to the north and east of the city. Oxford won by 22 points to 33 with Arthur Hernaman of Keble College coming home first. However, it was an unsatisfactory result as "Malicious boys tampered with the trail", causing two Cambridge runners to trail home a long way behind the field.

In the early years, the universities took it in turns to host the race. The Cambridge course started from the Hills Road railway bridge and from 1882 onwards, the Oxford course began at the University Arms on Cowley Road. They were always marked out by a paper trail. About ten minutes before the race started, two 'hares' from each university would depart and lay the trail for the 'hounds' to follow.Unsurprisingly, this method left considerable scope for the competitors, particularly those from the visiting side, to get lost and this often happened. The most infamous race for this was in 1886, held over a massive 9½-mile Oxford course from the University Arms to Shotover Hill, then Wheatley Windmill and back to the city via Horspath. In that year, Frederick Philpot (St. John's, Cambridge) was possibly denied victory when he lost the trail and William West (Christ Church) - one of Oxford's top runners - trailed in 20 minutes behind the pack.

1898 vmrace start isdn

1898 Varsity Match Start-line

1901 ouhhccuhh teams

1901 OUHHC and CUHH Teams

After Oxford's initial, and unsatisfactory, win, Cambridge asserted control and won seven races in a row up to 1887. Their dominance stemmed not only from a wealth of talent at their disposal, but internal problems that dogged Oxford. The Oxford University Hare and Hounds in those days were a part of O.U.A.C. and suffered from the prejudice that existed at that time towards the sport. The prevailing opinion was that cross-country work made a man slow for the 'path' and so O.U.A.C's top milers and three milers were generally discouraged from taking to the country. Oxford were slow to catch up, but did so by the late 1880s largely due to the efforts of William Pollock Hill (Keble) - the first real star of the race and winner in 1886, 1888 and 1889 - who successfully combined the two disciplines.

In 1890, after ten years alternating between Oxford and Cambridge, the race was well-established and the universities decided to seek a neutral course for the first time, largely because the Shotover and Gogs courses were regarded as "shockingly unfair" to the visiting side; Shotover with its fearsome hill and the Gogs with its notorious 'ploughs'. The clubs chose the Thames Hare and Hounds' course at Roehampton largely through the efforts of Robert Conway (St. Catharine's) who had run for Cambridge in 1883 and 1884 and had joined Thames in 1888. The intended course was the same as the one used in later years, apart from one small difference. Instead of starting in front of the King's Head on Roehampton Lane, the race began at the Drying Ground at the top of Roehampton High Street on Putney Heath with a straight run to the cross-roads at the top of Roehampton Lane. From there, it was down to Beverley Brook, across the watersplash, up Coombe Hill, down Coombe Lane to Raynes Park and then home via Cottenham Park, the Crooked Billet and a two-mile run-in across Wimbledon Common to the Old Well House on Putney Heath.

1908 start isdn

1908 Varsity Match Start-line

1946 vmwatersplash

Watersplash at 1946 Varsity Match

Sadly, the event was a fiasco as when the course approached the railway bridge on Raynes Park Meadows, the trail appeared to turn off under it, rather than turn back up Cottenham Slope towards Wimbledon Common. Thomas Colbatch-Clark (Trinity, Cambridge) followed this apparent trail and all the runners were brought to a halt on the other side when it disappeared. Once it had become clear to them that they had lost the trail, the runners decided to run home in a pack and made no attempt at racing. The spectators at the King's Head, therefore, had to endure an "anxious wait" and then had the "annoyance of seeing them trot home at their leisure." A no-race was consequently declared and the match was re-run at Oxford in February 1891, with the Dark Blues notching up their third win in a row.

After the disappointment of November 1890, the universities returned to the old format. However, seeking a neutral course was never far from their thoughts and, in 1896, they then decided to try Thames again and the race was successfully staged on Friday 4th December. Cambridge notched up a convincing 20 points to 35 victory, with William Gibberd (Trinity) leading them home.

Following the move to Roehampton, the two decades in the run up to the Great War were really the first golden era of the race. The London venue and the ever increasing standard of the teams meant that it had started to capture the attention of the press and the wider public. However, the outbreak of war in 1914 brought it to a temporary halt with Cambridge leading the series by 19 wins to 15.

Following a six year gap, the race returned in 1919 with Cambridge winning for the twentieth time. The first man home was Oxford's captain, Evelyn Montague (Magdalen), who went on to compete in the steeplechase at the 1924 Paris Olympics and was the basis for the character 'Aubrey Montague' in Chariots of Fire. However, the 1919 race was perhaps most notable for the performance of Andrew Telfer (Selwyn), who finished second. He had run in the last pre-war race in 1913 and had been so severely wounded in the war that it was feared he would never run again.

The following year saw the first change to the format since the inaugural race when the size of the sides was increased to six (although only the first five scored). 1920 also saw the staging of the only ever match between a combined Oxbridge side and an American university when Cornell visited and were defeated by 26 points to 29 in an exciting contest over the Roehampton course three weeks after the 'Varsity Race.

Five years later came a more significant change to the race. Increased development on the slopes leading back to the Common in the Raynes Park area had meant that a significant part of the middle of it were run on roads between houses. Furthermore, the construction of the Kingston Bypass in 1926 was threatening to cut off access to Coombe Hill. Therefore, the decision was made to move the race and after much deliberation, the Horton Kirby course in Kent was chosen. Some of this course lay across land owned by a Mr Fooks, whose son Tommy (Christ's) won the last Roehampton race in 1925. The first Horton Kirby race was held on December 11th 1926, with Oxford filling positions one to five and seven. In all, thirteen races were held at the hilly Kent venue up to the Second World War, when the race was brought to a halt again with Cambridge leading by 29 wins to 25.

1929 varsityxc nearstart 14dec29

1929 Varsity Match

The inter-war years also saw the instigation of the Second Team 'Varsity Race - which soon came to be known as the Tortoises-Spartans match after the names of the respective teams - in 1937. This was one of the first second team 'Varsity contests staged in any sport and was the first step to developing the IInds-Vths races, which are now always held on the Saturday before the Blues Match and alternate in venue between the universities.

Unlike in 1914, this time war did not mean a complete stopping of the race. From 1940 to 1945, six unofficial events were held. Due to the impracticality of holding the race at Horton Kirby, the race returned for the first time in fifty years to Oxford and Cambridge. The first race was held at Oxford in February 1940 and the last was held back at Roehampton over a new Thames course in February 1945. Cambridge were dominant during this period, winning five out of six.

Following the end of the war, arrangements were made for re-starting the official series and the 55th race was held in December 1945 at Roehampton. The new course bore no resemblance to the pre-1926 one as increased traffic on Roehampton Lane and the A3 meant that starting the race in front of the King's Head was no longer practical. It started at finished at the Big Holly Bush, close to where Roehampton Lane met the A3, and stayed completely on the Common. It formed the basis for the one used for the next 55 years.

Cambridge won the first two post-war races, but then Oxford moved into a period of dominance, winning eight of nine to 1955. This was the era of Oxford's middle distance stars, many of whom took part in the race. Runners of the calibre of Peter Curry (Oriel), Philip Morgan (Wadham), Jim Scott-Wilson (Magdalen), Ian Boyd (Brasenose), Tony Weeks-Pearson (St. Catherine's), Alan Gordon (Magdalen) and, of course, Roger Bannister (Exeter) and Chris Chataway (Magdalen) all donned the Dark Blue colours during this era. Also appearing in the race, although for Cambridge, was the other member of the four minute mile trio - Chris Brasher (St. John's). Chataway's third win in 1952 was the famous fog bound race run in one of the last of the London peasoupers, which claimed 1,500 lives. The 'Varsity Match had the distinction of being the only sporting event in London to survive the weather and was run over the special Thames fog course. Oxford recorded the biggest win ever in the series, 21 points to 66.

1949 varsityxc bannister wins 10dec49

Roger Bannister winning the 1949 Varsity Match

Following Oxford's success of the 1950s, Cambridge registered a similar run in the later-1950s and early-1960s. This period was dominated by Mike Turner and his Queens' College school of cross country and the Light Blues excelled in both the 'Varsity Race and British Universities' Championships. Alongside Turner, the club boasted runners of the calibre of Tim Johnston (Trinity), Tim Briault (St. John's), Herb Elliot (Jesus) - who was already an Olympic champion when he ran in the 1960 race, Martin Heath (Emmanuel) and Bruce Tulloh (Selwyn) and recorded possibly the greatest period of success the race has seen. Between 1958 and 1964, Cambridge lost only three out of the 28 Oxford-Cambridge races held (at this point there were annual matches for the Blues, Tortoises-Spartans and IIIrd and IVth teams).

However, by the late-1960s, Oxford had recovered and the race was changing once again. Although it no longer occupied quite the position it once had in the athletics calendar, it was still the stage for a number of very talented runners, among them Tony Moore (St. Edmund Hall), Bob Steele (New College), Julian Goater (St. Edmund Hall), Chris Garforth (Queens') and Warwick Ewers (Worcester), who by 1977 had set a new appearance record for the race with seven (to be equalled in 2002 by Nick Talbot (University)). In 1970, there was a significant move back to the past when, following completion of the pedestrian underpass on the A3 at the top of Roehampton Lane, the race was once again able to start in Roehampton village, this time next to the War Memorial on Putney Heath. Sadly, however, this change was only to last for five years as the King's Head, the venerable backdrop to the race since 1896, was lost to Thames in 1975. During that summer, the old stable block that housed the the changing rooms was gutted by fire and the club was forced to find a new home. By 1975, new headquarters at the Memorial Playing Fields, Roehampton Vale, had been completed and the race was able to continue, without interruption, over a new course.

1967 varsityxc snow pressassoc

1967 Varsity Match in the snow

1976 varsityxc oxford steadgrandwightmanhalfpennyskrinehudson 04dec76

1976 Ladies' Varsity Match - Stead, Grand, Wightman, Halfpenny, Skrine, Hudson

The other major event of the 1970s was the beginning of the ladies' race in 1976. The number of women at both universities had steadily grown in the post-war period and following the first Ladies 'Varsity Athletic Sports match in 1975, it was only natural that the cross-country runners would soon follow. Initial plans - which came from Oxford - were made to have a race on the day of the IInds toVths 'Varsity Matches the week before the 1975 Blues race. In the event, this never took place as an official match and after some discussion the first official race was staged a year later over a three mile course at Roehampton on the same day as the Gentlemen's Blues Race. Since then, the race has always taken place in conjunction with the gentlemen's match and, apart from 1984, it has always been held directly before it. Oxford won the first race by a maximum score of 10 points to 34 with Lynne Wightman (Lady Margaret Hall) the first runner home.

In 1990, the gentlemen's race celebrated its centenary and it was won for the fourth time in succession by Simon Mugglestone (Hertford and Keble), probably the finest runner ever to appear in it. However, the shine was taken off his victory by one of the biggest upsets in the event's history with Cambridge registering their first win for seven years. The Centenary Race also saw the re-introduction of the Beverley Brook watersplash - gone since 1972 - and the first Old Blues' Race, run over a six mile course before the two Blues matches. Six years later, the celebration of the 100th anniversary of the first hosting of the race by Thames Hare and Hounds was marked by a similar upset, but this time it was Oxford who ended a dismal losing sequence with narrow five point win.

While the Oxford gentlemen had been struggling in the early-1990s, their ladies had been putting together the longest run of success by either side in the history of the Blues races, eventually securing nine victories in a row between 1993 and 2001. Winning the first race in that sequence was Emma Coleman (Magdalen and Oriel) who made history by becoming the first person to win for both sides, having previously been victorious in 1991 while at Newnham, Cambridge. The 1996 race was significant for it saw Stephanie Cook (Lincoln) come home first. Four years later, she would be winning the gold medal for Great Britain in the modern pentathlon at the Sydney Olympics. 1996 also saw the first appearance in the race of Ellen O'Hare (Merton) who by 2003, now as Ellen Leggate (and of Peterhouse) had a new appearance record of eight (four for Oxford and four for Cambridge). 

This record was surpassed in 2019 when William Ryle-Hodges (Queens' & Magdalene, Cambridge and St. Antony's, Oxford) notched up his ninth appearance, seven for Cambridge (2011, 2012, 2013, 2016, 2017, 2018 and 2019) and two for Oxford (2014 and 2015). Only twice was he on the losing side (2017 and 2018), thus making him the most successful runner (in terms of team victories) in the contest's history. Although there were attempts to hold a race in December 2020, March 2021 and April 2021, the Covid-19 pandemic meant that there was no contest in the 2020-21 academic year. The race returned on Saturday, December 4th 2021 when Oxford took victory in the 45th Ladies' Race and Cambridge in the 130th Gentlemen's Race.

1986 varsityxc mathewspes 06dec86

1986 Varsity Match

Further details of the history of the Varsity Cross-Country Races can be found on the Thames Hare & Hounds website.